medicalexpo.de
medicalexpo - der b2b-marketplace für medizinische ausrüstung: medizinisches material, medizinische bildgebung, mobiliar für krankenhäuser, laborausrüstung...
Monthly Visitors are
Tags:
geräteproduktesystemefindenherstellervirtuelleanästhesiebauteileverzeichnisdoppler
Websites similar to medicalexpo.de - Top 11 medicalexpo.de Alternatives and Competitors

kavo.com
kavo is a dental products manufacturer with a comprehensive array of dental products ranges from skillfully designed dental instruments, practice equipment and dental x-ray machines.
Monthly Visitors are 85959.1962511 and Similarity percentage is 45.38.
Ranked 116808st globally in Health Health

praxisdienst.de
ihr zuverlässiger anbieter für praxisbedarf & medizinprodukte. arztbedarf & medizinbedarf kaufen sie günstig bei praxisdienst!
Monthly Visitors are 228112.268706 and Similarity percentage is 37.97.
Ranked 10188st globally in Health Health

rki.de
das robert koch-institut ist die zentrale einrichtung der bundesregierung auf dem gebiet der krankheitsüberwachung und –prävention. die kernaufgaben des rki sind die erkennung, verhütung und bekämpfung von krankheiten, insbesondere der infektionskrankheiten sowie die erhebung von daten und erarbeitung von studien für die entwicklung von präventionsempfehlungen im gesundheitswesen.
Monthly Visitors are 6508850.88609 and Similarity percentage is 36.98.
Ranked 490st globally in Health Health

meddax24.de
sie sind auf der suche nach ärztebedarf, medizintechnik, hygiene- und pflegeartikel? dann sind sie bei uns genau richtig! zuverlässig, gut und güns...
Monthly Visitors are 62172.0505393 and Similarity percentage is 36.85.
Ranked 24406st globally in Health Health

antigen-schnelltests.com
Monthly Visitors are 20502.6263798 and Similarity percentage is 35.69.
Ranked 126245st globally in Health Health

bbraun.de
b. braun entwickelt wirksame lösungen und richtungsweisende standards für das gesundheitswesen, im konstruktiven austausch mit anwendern und partnern.
Monthly Visitors are 82957.5356657 and Similarity percentage is 35.66.
Ranked 24604st globally in Health Health

bauerfeind.de
wir bieten innovative produkte aus den bereichen: bandagen, orthesen, medizinische kompressionsstrümpfe und orthopädische einlagen - "made in germany".
Monthly Visitors are 322261.127946 and Similarity percentage is 35.23.
Ranked 9428st globally in Health Health

medexsupply.com
medexsupply is the one of the largest national suppliers of discount medical, surgical, durable, lab & home healthcare supplies and equipment. compare and save today.
Monthly Visitors are 51250.5810152 and Similarity percentage is 35.20.
Ranked 229523st globally in Health Health

conmed.com
medical supplies and equipment
Monthly Visitors are 39349.6232973 and Similarity percentage is 35.00.
Ranked 200112st globally in Health Health

medi.de
innovative lösungen für mehr lebensqualität – mit den marken medi, cep und item m6. kompressionsstrümpfe, orthopädische hilfsmittel, sport- und fashion-produkte.
Monthly Visitors are 322811.239602 and Similarity percentage is 35.00.
Ranked 9668st globally in Health Health

smiths-medical.com
smiths medical us website homepagewe bring technology to lifethe smiths medical medical device portfolio incorporates established brands and strong positions in select segments of the infusion systems, vascular access and vital care markets in the usa. we provide innovative solutions and superior support to help healthcare professionals and providers ensure safety, enhance patient outcomes and improve the total cost of care in the united states.at smiths medical, we are passionate about improving and saving the lives of patients through high quality, innovative medical devices and services.us, usa, north america, america, united state of america, american, united states
Monthly Visitors are 84471.6697257 and Similarity percentage is 35.00.
Ranked 112897st globally in Health Health